PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00172.1.g00270.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 278aa    MW: 30640.2 Da    PI: 5.188
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00172.1.g00270.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.22.5e-151461148
                                    TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                 Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                    rg+WT+eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl
  Zmw_sc00172.1.g00270.1.sm.mkhc 14 RGPWTAEEDRKLINFILSNGHCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                                    89******************************99************97 PP

2Myb_DNA-binding50.83.9e-1670111447
                                     S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                 Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                      T  E++  +d++++lG++ W++Ia++++ gRt++++k++w+++
  Zmw_sc00172.1.g00270.1.sm.mkhc  70 LTDAEEQVVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                                     5899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.458961IPR017930Myb domain
SuperFamilySSF466892.45E-2611108IPR009057Homeodomain-like
SMARTSM007174.5E-121363IPR001005SANT/Myb domain
PfamPF002495.4E-141461IPR001005SANT/Myb domain
CDDcd001672.04E-91661No hitNo description
PROSITE profilePS5129427.53662116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-2563117IPR009057Homeodomain-like
SMARTSM007172.5E-1466114IPR001005SANT/Myb domain
PfamPF002498.3E-1470111IPR001005SANT/Myb domain
CDDcd001672.06E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MGRQPCCDKL GVKRGPWTAE EDRKLINFIL SNGHCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL TDAEEQVVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
IDPVTHEPLD RTCSPAAATA TSQSVVTTDH SDEMSKPQRP QDDASRDVSG DGSTSLPESS  180
TNTTSTGGSS NSSGGSHDQD PLVKWLLEED PPTGDEPWLS FPGTVDVDEF SSMATDPAPL  240
PWDGTTDWLL DYQDFGLADW SLVLDEYMVS SSNGSKSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957458.11e-152PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-98ODO1_PETHY; Protein ODORANT1
TrEMBLK3ZVW91e-152K3ZVW9_SETIT; Uncharacterized protein
STRINGSi030750m1e-151(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563